PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33961-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 90aa    MW: 10232.6 Da    PI: 10.6463
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33961-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.71.9e-112284163
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke e+  +e+ +l+  +
  TRIUR3_33961-P1 22 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNESMKKEKETVMQEYLTLQETN 84
                     89******************************************************9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.8E-61986No hitNo description
PfamPF001707.7E-102284IPR004827Basic-leucine zipper domain
SMARTSM003381.1E-112286IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.9672487IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-72681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
AAAAPGGGGY GPRPRHTLTE AEKEAKRLRR VLANRESARQ TILRRQAIRD ELARKVADLS  60
SQNESMKKEK ETVMQEYLTL QETNKQLKEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757911.16e-50PREDICTED: G-box-binding factor 3-like
TrEMBLT1NT127e-59T1NT12_TRIUA; Uncharacterized protein
STRINGBGIOSGA034827-PA3e-47(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-17bZIP family protein